Growth Hormone Secretagogue
IGF-1 LR3 (Long R3 IGF-1, LR3IGF-I) is a recombinant analog of human insulin-like growth factor 1 produced in E. coli. It differs from the 70-residue native hormone in two ways: glutamate at position 3 is replaced by arginine (the “R3”), and a 13-residue extension peptide derived from the first 11 residues of methionyl porcine growth hormone plus Val-Asn is fused to the N-terminus (the “Long”), giving an 83-residue protein of about 9.1 kDa [1]. Both changes target the same problem. In serum and in culture, most IGF-1 is sequestered by six IGF-binding proteins (IGFBP-1 to -6) that limit how much free ligand reaches the type 1 IGF receptor; the Glu3 side chain and the N-terminus are part of the IGFBP contact surface, and altering them cuts binding-protein affinity by orders of magnitude while leaving receptor activation largely intact.
The compound comes from the Adelaide group of Ballard and Francis, who in 1992 described an E. coli expression system for IGF-1 fusion proteins and compared Long IGF-1, Long [Gly3]-IGF-1 and Long [Arg3]-IGF-1 with native IGF-1 and des(1-3)IGF-1. The hydrophobic extension improved folding yields, and in L6 rat myoblasts all the analogs were more potent than IGF-1 at stimulating protein and DNA synthesis and inhibiting protein breakdown; the advantage was largest in cell lines that secrete IGFBPs into the medium, which is the direct signature of reduced binding-protein capture [1]. The same year, Tomas et al. showed in dexamethasone-treated rats that LR3IGF-I and des(1-3)IGF-I were roughly 2.5-fold more potent than IGF-1 at restoring nitrogen balance and body weight, despite LR3IGF-I binding the type 1 IGF receptor about three-fold less well — the gain came from escaping the elevated IGFBP-3 in those animals [2].
LR3 IGF-1 was engineered for, and is overwhelmingly used in, serum-free mammalian cell culture. Insulin is the traditional growth and survival supplement for Chinese hamster ovary (CHO) cells, the workhorse host for therapeutic antibodies and recombinant proteins. Morris and Schmid (2000) compared insulin with LongR3 in two serum-free CHO lines producing recombinant cytokine receptors and found that LongR3 better sustained viability under production conditions, making it the preferred growth factor for both lines [3]. Voorhamme and Yandell (2006) reported that LONG R3IGF-I supports CHO growth and survival at concentrations at least 200-fold lower than insulin and is a more potent mitogen than either insulin or native IGF-1 in HEK293 cells, activating both the type 1 IGF receptor and the insulin receptor in a dose-responsive, bell-shaped manner [4]. Because it is not captured by the IGFBPs that cultured cells secrete, a small amount stays bioavailable for the whole batch, which is why the compound appears in commercial chemically-defined media formulations under the LONG R3IGF-I name. Clemmons' 2018 review of the IGFBP system explains the underlying biology: IGFBPs are the main determinant of how much IGF-1 reaches its receptor, and analogs that evade them behave very differently from the native ligand [5].
IGF-1 and its analogs are prohibited at all times under the World Anti-Doping Code, and a 2009 review in Current Drug Abuse Reviews summarised the pharmacology, the anecdotal misuse of IGF-1 preparations in sport, and the limited evidence for any performance effect alongside the recognised risks of hypoglycaemia and long-term mitogenic exposure [6]. LR3 IGF-1 has no approved medical indication in any jurisdiction; the IGF-1 product that is approved (mecasermin, recombinant native IGF-1) is a different molecule with a different pharmacokinetic profile.
There are no human clinical trials of LR3 IGF-1. The animal data consist of short catabolic-model studies in rats [2]; the rest of the literature is cell biology and bioprocess engineering [1][3][4]. Nothing establishes efficacy or safety for muscle, recovery, fat loss or ageing in humans, and the very feature that makes the analog useful in a bioreactor — escape from binding-protein regulation — removes the physiological brake that limits IGF-1 receptor exposure in an organism. IGF-1 receptor signalling is mitogenic and anti-apoptotic, so uncontrolled exposure carries theoretical oncogenic and hypoglycaemic risk that has not been characterised for this analog [5][6]. This material is supplied strictly for in-vitro laboratory research.
| Molecular formula | C400H619N111O115S9 (calculated from sequence, three disulfide bonds) |
|---|---|
| Molecular weight | approx. 9111 Da (calculated; 83 amino acids) g/mol |
| Amino-acid sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (13-residue N-terminal extension + human IGF-1 with Glu3 replaced by Arg) |
Format. Lyophilized recombinant protein in a sealed glass vial, offered in 100 mcg and 1 mg sizes to suit small-scale assay work or larger media-supplementation runs. Note that typical cell-culture working concentrations are in the nanogram-per-millilitre range, so a 100 mcg vial supports a substantial volume of medium.
Reconstitution. As a folded 9 kDa protein with three disulfide bonds, LR3 IGF-1 is more sensitive to shear and surface adsorption than short peptides. Reconstitute with sterile water or a mildly acidic buffer (for example 10 mM HCl or 0.1 M acetic acid, as is standard for IGF-1 proteins), let the powder wet and dissolve without agitation, and dilute into medium containing carrier protein where possible. Our reconstitution calculator converts vial mass and diluent volume into concentration. Do not vortex or shake.
Storage. Lyophilized vials are typically stored at −20 °C and protected from light. Reconstituted stock should be aliquoted into low-protein-binding tubes and frozen at −20 °C or below; avoid repeated freeze-thaw cycles, which cause aggregation and loss of activity. Working dilutions in medium are generally used within a day.
Handling. Standard laboratory practice applies: appropriate PPE, aseptic technique when reconstituting, and disposal in line with your institution's procedures. For in-vitro laboratory research only — not for human or veterinary use.