Healing & Recovery
Returns: 14-day returns on un-opened, untampered items in original condition. Return shipping is paid by the buyer. Full policy →
TB-500 is a man-made peptide that matches an active piece of thymosin beta-4 (Tβ4), a small natural protein (about 43 amino-acid building blocks long) found in body fluids and inside cells. Its job in the body involves handling actin, a protein that helps cells keep their shape and move. In research, the full protein and its pieces have been studied as compounds that may support repair and the growth of new blood vessels [3][4].
Thymosin beta-4's best-understood role is binding actin — it grabs single actin building blocks and helps control the cell's internal framework and how cells move [3][4]. Studies have also looked at how it affects the growth of new blood vessels through the behavior of endothelial cells (the cells that line blood vessels). One study looked at how it regulates the Notch/NF-κB pathway (a set of cell signals involved in growth and inflammation) in mice with severe reduced blood flow in a limb [2].
Several animal studies have looked at thymosin beta-4 in wound-healing tests. A rat study on deep skin wounds reported faster healing and more new blood vessels [1]. A lab-made version was tested on deep skin wounds in mice [5], and slow-release gel-like scaffolds were studied in diabetic rats with poor blood flow in the hind leg [6]. Reviews summarize reported effects on new blood-vessel growth, inflammation, cell survival, and scarring in repair studies [3][4].
Specially designed thymosin-based peptides have been studied for healing of the cornea (the clear front of the eye) in lab tests, reflecting interest in the peptide's effects on cell movement and inflammation [7].
Researchers have also looked at thymosin beta-4 as a possible regulator of hepatic stellate cells (liver cells involved in scarring) in studies of liver injury and fibrosis (scar-tissue buildup) [8].
Most of the evidence comes from test-tube and animal studies. Some early human research on related thymosin products exists, but solid proof of how well TB-500 works and how safe it is in people has not been established. This product is supplied strictly for laboratory research use only.
| Molecular formula | C212H350N56O78S |
|---|---|
| Molecular weight | 4963 g/mol |
| Amino-acid sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| PubChem | CID 45382195 ↗ |
View COA — TB-500 (Thymosin Beta-4) →
For laboratory use, lyophilized TB-500 / Thymosin Beta-4 powder is typically reconstituted with sterile or bacteriostatic water. Store the lyophilized powder at -20°C for long-term stability; keep reconstituted solutions at 2-8°C and use within a short working window. Aliquot to minimize freeze-thaw cycles and protect the material from light and elevated temperatures.